PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3286s0004.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 382aa    MW: 42653.6 Da    PI: 6.1848
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3286s0004.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like41.92.2e-1367962655
              G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kA Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Araha.3286s0004.2.p 67 KAGPKKILDLMNVPWLTRENVASHLQKYRL 96
                         899**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015574.4E-116796IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.5E-1467101IPR009057Homeodomain-like
SuperFamilySSF466891.15E-668100IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MKHIFLEVVK MFLLVKREKT LTLRRSFFKM RVIHHLLLPR KLGLCGLLSF IRSLSTPLTK  60
SDAITVKAGP KKILDLMNVP WLTRENVASH LQKYRLYLSR LEKGKELKCY SGGVKNMDSS  120
PKDAEVNSGY QSPGKSSYVF SGGNSLIQKV TEIDPKPLAS ASLSDPNTDV IMPPKTKKTR  180
IGFDPPISSS SAFDSLLPWN DVPETLESKP VLYENSFLQQ QPLPSQSSYV ANSVPSLMEE  240
EMKSPYETPA GGSSVNVDEF LMPQDKNPSV TLQDLDPSAI SNLKLQEFSS NVTNNTEAIL  300
RSLNWEIPES HHSASLDTDL DLIWLQGERF LANTGLQFQD YSSSPSLLSE LSPHLWYGNE  360
RLPDPDEYSF MVDQGNQLVV I*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11219LLVKREKT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0415320.0AB041532.1 Arabidopsis thaliana ARR11 mRNA for response regulator 11, complete cds.
GenBankAJ0051940.0AJ005194.1 Arabidopsis thaliana mRNA for receiver-like protein 3.
GenBankAK2282160.0AK228216.1 Arabidopsis thaliana mRNA for response regulator 11, complete cds, clone: RAFL14-66-N10.
GenBankBT0087680.0BT008768.1 Arabidopsis thaliana At1g67710 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888617.10.0hypothetical protein ARALYDRAFT_894522
SwissprotQ9FXD60.0ARR11_ARATH; Two-component response regulator ARR11
TrEMBLD7KVN10.0D7KVN1_ARALL; Putative uncharacterized protein
STRINGscaffold_201596.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-178response regulator 11